PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.6G152600.1.p
Common NameLOC101785019, SETIT_013716mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 456aa    MW: 47034.9 Da    PI: 7.6275
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.6G152600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.94e-32255308255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt+ LH+rFv+ave LGG+++AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Seita.6G152600.1.p 255 PRMRWTSSLHARFVHAVELLGGHDRATPKSVLELMDVKDLTLAHVKSHLQMYRT 308
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.34E-15252309IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.9E-29253309IPR009057Homeodomain-like
TIGRFAMsTIGR015577.4E-24255308IPR006447Myb domain, plants
PfamPF002496.8E-7256307IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MEARAASAPD LSLHISLPSS AASPPPSTAP GRLGAAGGGA RGAPAAGGDP WRRLNGSTAS  60
TELSLSPPPR QEAAGDALPW RLRPPAANYS SSAAATAEAA SSFVPATVPR FSLDAAAEAQ  120
VARARPINGV PVYSSPRAAG HPFLGAASDY RHGHQKVGLY NPYHHASSWP SSLRSATATS  180
PAVASDPGAT AFLSPSAYHR MLSGTSRLHL HGVLADTLRG YGGGHHHQQQ PHLGSLASAR  240
YMPKFPASRR GMRAPRMRWT SSLHARFVHA VELLGGHDRA TPKSVLELMD VKDLTLAHVK  300
SHLQMYRTVK STDKPATSSG PVDGGGSGDD DLPVPDAGQA PSAGGDTSPQ TITGHRSASS  360
EGAASHAGGD VECSSADDSD GGQPRSGASS RDQWLPPGAC NAETHNSVGI SSTIEDMEPC  420
GSVGLQQVAN HEVSCPSPSL EFTLGRPNWN RMEHD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ2865271e-143DQ286527.1 Zea mays KANADI1-like protein (kan1a) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973472.10.0PREDICTED: probable transcription factor RL9
SwissprotQ0J2354e-99ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLK3YHJ80.0K3YHJ8_SETIT; Uncharacterized protein
STRINGSi013716m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.13e-48G2-like family protein